Pramlintide
Synthetic amylin analog (37 amino acids); first-in-class amylin receptor agonist for adjunctive diabetes therapy. Mechanistic precursor to cagrilintide and CagriSema.
Quick Facts
| Property | Value |
|---|---|
| Also Known As | Symlin, AC137, Pramlintide acetate |
| Category | Amylin Receptor Agonist (Metabolic) |
| Sequence | KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (Pro25,28,29 substitutions vs. native amylin to prevent aggregation) |
| Molecular Weight | ~3951 Da |
| Molecular Formula | C171H267N51O53S2 |
| PubChem CID | 16129704 |
| Administration | SubQ before meals (3x daily with major meals) |
| Typical Dose Range | T2D: 60-120 mcg per meal; T1D: 15-60 mcg per meal |
| Half-Life | ~48 minutes |
| Storage | Refrigerate 2-8C; opened vials/pens stable at room temperature or refrigerated for up to 30 days |
| FDA Status | FDA Approved (2005) โ Adjunct to mealtime insulin in T1D and T2D |
| WADA Status | Not listed as prohibited |
Mechanism of Action
Pramlintide is a synthetic analog of amylin (islet amyloid polypeptide, IAPP), a 37-amino-acid peptide hormone co-secreted with insulin from pancreatic beta cells in an approximately 1:100 amylin:insulin molar ratio. In type 1 diabetes, amylin is virtually absent due to beta-cell destruction. In type 2 diabetes, amylin secretion becomes deficient relative to metabolic demand. Pramlintide was designed with three proline substitutions (at positions 25, 28, and 29) to prevent the amyloid aggregation that makes native human amylin unsuitable as a drug.
Pramlintide acts through a distinct receptor system from GLP-1. The amylin receptor consists of the calcitonin receptor (CTR) complexed with receptor activity-modifying proteins (RAMPs), particularly RAMP1, RAMP2, and RAMP3, forming AMY1, AMY2, and AMY3 receptor subtypes respectively. Pramlintide activates all three subtypes.
Pramlintide addresses postprandial glucose excursions through three complementary mechanisms, all of which are mechanistically distinct from the GLP-1 pathway:
-
Slowing gastric emptying โ Pramlintide activates amylin receptors in the area postrema and vagal afferents to delay nutrient entry into the duodenum, reducing the rate of glucose appearance in the blood after meals.
-
Suppressing postprandial glucagon secretion โ Unlike GLP-1 (which suppresses glucagon in a glucose-dependent manner), pramlintide suppresses inappropriate postprandial glucagon release from alpha cells, reducing hepatic glucose output after meals.
-
Promoting satiety โ Pramlintide acts on the area postrema and hypothalamus (ventromedial hypothalamus, arcuate nucleus) to enhance satiety, reduce meal size, and decrease caloric intake. This central satiety effect is mediated through a neural pathway distinct from the hypothalamic GLP-1R-mediated satiety pathway.
The independence of the amylin and GLP-1 pathways is the pharmacological foundation for combining amylin analogs with GLP-1 RAs โ as realized in the development of CagriSema (cagrilintide + semaglutide).
Key Research Areas
- Postprandial Glucose Control โ Pramlintide reduces postprandial glucose excursions by 40-60% when added to insulin in both T1D and T2D
- Weight Loss in Diabetes โ Modest but significant weight loss (~1-2 kg placebo-subtracted in T2D) โ the opposite direction of insulin-induced weight gain (PMID: 21199269)
- Weight Loss in Obesity โ 12-month trial showed sustained weight loss of 6-8 kg in obese non-diabetic adults (PMID: 18753666)
- Amylin Physiology โ Established pramlintide as proof-of-concept for the amylin pathway in metabolic regulation (PMID: 18561511)
- Combination Approaches โ Pramlintide + metreleptin (leptin) showed enhanced weight loss (~12.7% at 24 weeks), validating multi-hormone approaches
Evidence Level Summary
| Evidence Type | Count | Notes |
|---|---|---|
| Human RCTs | 15+ | Phase 2/3 in T1D, T2D, and obesity |
| Human observational | 5+ | Real-world adherence and outcomes |
| Animal in vivo | 10+ | Amylin pathway characterization, CNS satiety studies |
| In vitro | 5+ | Receptor binding, RAMP interaction studies |
| Systematic reviews | 3+ | Meta-analyses of glycemic and weight outcomes |
Clinical Applications
- Type 2 Diabetes โ FDA-approved adjunct to mealtime insulin; reduces HbA1c by ~0.3-0.4% while preventing insulin-associated weight gain
- Type 1 Diabetes โ FDA-approved for T1D patients requiring mealtime insulin; reduces postprandial glucose spikes
- Weight Management โ Weight loss mechanism provides dual benefit with glycemic control
- Metabolic Syndrome โ Improvements in postprandial metabolic parameters
Protocols Using This Peptide
- Weight Loss Protocol โ Referenced as amylin-pathway agent; foundational for understanding Cagrilintide
- Metabolic Reset Protocol โ Potential component for patients requiring both glycemic and weight optimization
Ageless Peps Products
Pramlintide is an FDA-approved pharmaceutical (Symlin) and is NOT sold by Ageless Peps. However, understanding pramlintide is CRITICAL for practitioners using Ageless Peps' Cagrilintide product, as cagrilintide is a next-generation long-acting amylin analog that builds directly on pramlintide's mechanism.
Related Ageless Peps products via the amylin pathway:
- Cagrilintide Vial (WC ID: 664, $96) โ Long-acting amylin analog, same receptor target as pramlintide
Dosing Reference
FDA-Approved Dosing
| Route | Dose Range | Frequency | Duration | Source |
|---|---|---|---|---|
| SubQ (T2D) | 60 mcg -> 120 mcg | Before each major meal (2-3x daily) | Ongoing | FDA label |
| SubQ (T1D) | 15 mcg -> 30 mcg -> 60 mcg | Before each major meal (2-3x daily) | Ongoing | FDA label |
Dose Titration
- T2D: Start at 60 mcg before meals; increase to 120 mcg when nausea subsides (typically 3-7 days). Reduce pre-meal insulin by 50% when initiating pramlintide.
- T1D: Start at 15 mcg before meals; increase by 15 mcg increments at 3-day intervals to 30 mcg, then 45 mcg, then 60 mcg. Reduce pre-meal insulin by 50% at initiation.
Cycling
No cycling. Continuous use as adjunct to insulin. Insulin doses should be re-titrated upward based on glycemic targets once pramlintide dose is stable.
Contraindications & Safety
- Contraindications: Gastroparesis, hypoglycemia unawareness (critical: pramlintide + insulin can cause severe hypoglycemia if insulin is not dose-reduced)
- Common side effects: Nausea (28-48%, dose-dependent, generally transient first 2-4 weeks), headache, anorexia, vomiting, abdominal pain
- Drug interactions: Must reduce mealtime insulin by 50% at initiation (hypoglycemia risk); slows gastric emptying โ may delay absorption of oral medications requiring rapid onset; space oral drugs requiring rapid absorption by 1 hour
- Pregnancy/nursing: Category C; insufficient human data
- Special populations: Not studied in severe renal/hepatic impairment; not approved in pediatrics; requires patient education on insulin co-administration to prevent severe hypoglycemia
Synergistic Combinations
- Insulin (not a peptide in the vault) + Pramlintide โ The FDA-approved combination; pramlintide addresses the postprandial component insulin alone cannot
- Semaglutide โ The amylin + GLP-1 dual-pathway concept is realized in CagriSema; theoretically, pramlintide + any GLP-1 RA achieves complementary satiety and glycemic effects
- Cagrilintide โ Next-generation replacement for pramlintide (once-weekly vs. three-times-daily); shares the same amylin receptor mechanism
Related Research
| PMID | Title | Year | Study Type |
|---|---|---|---|
| 21199269 | Effect of pramlintide on glycemic control and weight: systematic review and meta-analysis | 2011 | Systematic Review |
| 18561511 | Pramlintide: physiology, pathophysiology, and vascular risk | 2008 | Narrative Review |
| 18753666 | Sustained weight loss following 12-month pramlintide treatment in obesity | 2008 | RCT |
References
- PMID 21199269 โ Pramlintide glycemic control and weight meta-analysis
- PMID 18561511 โ Pramlintide physiology/pathophysiology review
- PMID 18753666 โ 12-month obesity weight loss trial
Related
#peptide #metabolic #fda-approved #not-sold #subq