GLP-1 (Native)
Endogenous incretin hormone secreted by intestinal L-cells; potentiates glucose-dependent insulin secretion and suppresses appetite via GLP-1 receptor activation
Quick Facts
| Property | Value |
|---|---|
| Also Known As | Glucagon-Like Peptide-1, GLP-1(7-36) amide, incretin, proglucagon fragment 78-107 |
| Category | Metabolic / Endocrine |
| Sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVKGR (30 amino acids, GLP-1 7-36 amide active form) |
| Molecular Weight | 3297.6 Da |
| Molecular Formula | C₁₄₉H₂₂₅N₃₉O₄₆ |
| PubChem CID | 56841596 |
| Administration | SubQ (research); endogenously secreted by intestinal L-cells and brainstem NTS neurons |
| Typical Dose Range | 0.5-1.5 pmol/kg/min IV infusion (research studies); not used clinically as a drug due to ultrashort half-life |
| Half-Life | <2 minutes (rapidly degraded by DPP-4 and NEP 24.11) |
| Storage | Lyophilized: -20°C; Reconstituted: 2-8°C, use within 7 days |
| FDA Status | Not approved as a drug; the native peptide's ultrashort half-life makes it impractical as a therapeutic. Modified analogs (semaglutide, liraglutide, dulaglutide, exenatide) are FDA-approved |
| WADA Status | Not listed |
Mechanism of Action
GLP-1(7-36) amide is the primary bioactive form of glucagon-like peptide-1, produced by post-translational processing of proglucagon in intestinal L-cells concentrated in the ileum and colon. It is secreted within minutes of nutrient ingestion (particularly glucose, fatty acids, and amino acids) as part of the "incretin effect" — the observation that oral glucose elicits 50-70% greater insulin secretion than IV glucose at matched glycemic levels (PMID-29364588).
Upon release, GLP-1 activates the GLP-1 receptor (GLP-1R), a class B G protein-coupled receptor expressed on pancreatic beta-cells, alpha-cells, hypothalamic neurons, brainstem neurons, cardiomyocytes, and vascular endothelium. At the beta-cell, GLP-1R activation triggers cAMP/PKA and cAMP/Epac2 signaling cascades that potentiate glucose-dependent insulin secretion — critically, this insulinotropic effect is glucose-dependent, meaning GLP-1 does not cause hypoglycemia when glucose levels are normal (PMID-17928588).
GLP-1 simultaneously suppresses glucagon secretion from pancreatic alpha-cells, delays gastric emptying via vagal afferent signaling, and activates hypothalamic appetite-suppressing circuits. Central GLP-1 receptors in the arcuate nucleus and paraventricular nucleus modulate POMC/CART (anorexigenic) and NPY/AgRP (orexigenic) neuronal activity, producing dose-dependent reductions in food intake of 15-30% in human infusion studies (PMID-24811133). Brainstem preproglucagon neurons in the nucleus tractus solitarius (NTS) also produce GLP-1, creating a parallel central signaling system that integrates peripheral satiety signals with appetite circuits (PMID-31002893).
The native peptide's clinical utility is fundamentally limited by its ultrashort half-life of approximately 2 minutes, as dipeptidyl peptidase-4 (DPP-4) cleaves the N-terminal His-Ala dipeptide to generate the inactive metabolite GLP-1(9-36) amide. This rapid degradation established the pharmacological rationale for two major drug classes: DPP-4 inhibitors (sitagliptin, etc.) that protect endogenous GLP-1, and DPP-4-resistant GLP-1 receptor agonists (semaglutide, liraglutide) that provide sustained receptor activation (PMID-17928588).
Key Research Areas
-
Incretin Physiology & Glucose Homeostasis — GLP-1 accounts for approximately 50-70% of the postprandial incretin effect. In type 2 diabetes, this incretin effect is markedly impaired, with GLP-1 retaining partial efficacy while GIP loses most of its insulinotropic potency. This differential preservation underpins the success of GLP-1-based therapies in T2D (PMID-29364588).
-
Appetite Regulation & Weight Control — GLP-1 reduces food intake through dual peripheral (vagal afferent gastric emptying delay) and central (hypothalamic POMC/CART activation) mechanisms. Human infusion studies demonstrate dose-dependent reductions in caloric intake and subjective hunger ratings (PMID-24811133).
-
L-Cell Secretion Mechanisms — L-cell GLP-1 secretion is regulated by luminal nutrient sensing via SGLT1 (glucose), GPR40/GPR120 (fatty acids), CaSR/GPRC6A (amino acids), and bitter taste receptors (polyphenols). Short-chain fatty acids from gut microbiota act on GPR41/GPR43 to modulate secretion (PMID-26637406, PMID-27287542).
-
Neuroprotection & Cognitive Effects — Central GLP-1R activation modulates mesolimbic dopamine signaling, exerts anti-apoptotic effects, reduces neuroinflammation via NF-kB suppression, and enhances synaptic plasticity. Preclinical evidence supports GLP-1R agonists as potential therapeutics for Alzheimer's and Parkinson's disease (PMID-31002893).
-
Cardiovascular Protection — GLP-1R activation produces direct effects on cardiomyocytes and endothelial cells, reduces atherosclerotic plaque inflammation, and attenuates NF-kB signaling in macrophages. These effects appear independent of weight loss and glycemic improvement (PMID-33320179).
-
Translational Drug Development — Understanding native GLP-1 biology yielded two blockbuster drug classes (GLP-1 RAs and DPP-4 inhibitors), dual agonists (tirzepatide), and triple agonists (retatrutide), now used by tens of millions of patients worldwide (PMID-29202475).
Evidence Level Summary
| Evidence Type | Count | Notes |
|---|---|---|
| Human RCTs | 0 | Native GLP-1 studied via IV infusion protocols, not as a standalone therapeutic |
| Human observational | 0 | Extensive observational data exists for GLP-1 RAs (analogs), not the native peptide |
| Animal in vivo | 0 | Foundational rodent physiology studies integrated into reviews |
| In vitro | 0 | L-cell models, perfused intestine preparations integrated into reviews |
| Narrative reviews | 6 | Comprehensive reviews spanning physiology, secretion, signaling, and drug development |
Clinical Applications
- Weight Management — GLP-1 is the endogenous mediator of meal-related satiety; understanding its physiology is essential for rational use of GLP-1 RAs and nutraceutical approaches to enhancing endogenous secretion
- Type 2 Diabetes — The impaired incretin effect in T2D is the pathophysiological basis for GLP-1-based therapies; native GLP-1 retains partial efficacy in T2D while GIP does not
- Metabolic Syndrome — GLP-1 signaling improves multiple metabolic parameters: insulin sensitivity, glucagon suppression, lipid metabolism, and inflammation
- Neuroprotection — Central GLP-1R activation provides anti-inflammatory and neurotrophic effects relevant to neurodegenerative disease
- Cardiac Health — GLP-1R-mediated cardiovascular protection via anti-inflammatory and direct cardioprotective mechanisms
Protocols Using This Peptide
- Weight Loss Protocol — GLP-1 pathway modulation is the mechanistic foundation
- Metabolic Reset Protocol — Enhancing endogenous GLP-1 secretion as an adjunct strategy
Ageless Peps Products
Note: The GLP-1 Vial (WC ID 724, $130) is currently in DRAFT status on the Ageless Peps store and is not published. No product note has been created. When this product goes live, a Product note should be created.
No published Ageless Peps products contain native GLP-1 peptide.
BrainIQ Products Supporting GLP-1 Pathways
The Weight Loss FAST Melts are BrainIQ Health nutraceutical products sold on the Ageless Peps store. They do NOT contain GLP-1 peptide or any GLP-1 receptor agonist drug. Instead, they contain natural ingredients (African Mango, Berberine, Cissus quadrangularis, L-Carnitine, GBB, MCT Oil, NMN/NAD+, Allulose) that may support endogenous GLP-1 secretion pathways — particularly berberine's AMPK activation and potential L-cell stimulation.
- AP-GLP1-FastMelts-Manuka — Weight Loss FAST Melts (Manuka Honey), $75
- AP-GLP1-FastMelts-Chocolate — Weight Loss FAST Melts (Chocolate), $75
- AP-GLP1-FastMelts-Caramel — Weight Loss FAST Melts (Caramel), $75
These are nutraceutical supplements, not pharmaceuticals. They should never be positioned as equivalent to prescription GLP-1 receptor agonists. The detailed ingredient science belongs in the BrainIQ vault.
Dosing Reference
Research Dosing Ranges (from literature)
| Route | Dose Range | Frequency | Duration | Source |
|---|---|---|---|---|
| IV infusion | 0.5-1.5 pmol/kg/min | Continuous infusion (research) | Acute (minutes-hours) | PMID-17928588 |
| SubQ | Not clinically used | N/A | N/A | Half-life too short (~2 min) |
Cycling
Not applicable. Native GLP-1 is not used as an exogenous therapeutic due to its 2-minute half-life. For sustained GLP-1R activation, DPP-4-resistant analogs (semaglutide, liraglutide) or DPP-4 inhibitors are used instead. Endogenous GLP-1 secretion can be augmented through dietary strategies (protein-rich meals, polyphenols, prebiotic fiber) without cycling concerns.
Contraindications & Safety
- Contraindications: Native GLP-1 has no specific contraindications as an endogenous hormone. For exogenous GLP-1 RAs: personal/family history of medullary thyroid carcinoma, MEN-2 syndrome, history of pancreatitis
- Common side effects: IV GLP-1 infusion at pharmacological doses can cause nausea, vomiting, and delayed gastric emptying
- Drug interactions: DPP-4 inhibitors increase endogenous GLP-1 levels; sulfonylureas combined with GLP-1 pathway enhancement increase hypoglycemia risk
- Pregnancy/nursing: GLP-1 RAs are contraindicated in pregnancy (Category C); endogenous GLP-1 physiology is normal during pregnancy
- Special populations: The incretin effect is impaired in elderly and T2D populations; GLP-1 secretion may be reduced in obesity and after bariatric surgery (though paradoxically increased post-RYGB)
Synergistic Combinations
- GLP-2 — Co-secreted from the same L-cells via proglucagon processing; GLP-1 handles metabolic/appetite effects while GLP-2 handles intestinal trophic effects. Understanding this co-secretion is key to the proglucagon biology framework
- Semaglutide — DPP-4-resistant GLP-1 RA that provides sustained activation of the same receptor native GLP-1 activates transiently
- Tirzepatide — Dual GIP/GLP-1 agonist that activates both incretin receptor systems, recapitulating and amplifying the full incretin effect
- Retatrutide — Triple GIP/GLP-1/glucagon agonist that adds glucagon receptor-mediated hepatic lipid oxidation to the incretin backbone
Related Research
| PMID | Title | Year | Study Type |
|---|---|---|---|
| PMID-17928588 | The Physiology of Glucagon-Like Peptide 1 | 2007 | Narrative Review |
| PMID-24811133 | Effects of GLP-1 on Appetite and Weight | 2014 | Narrative Review |
| PMID-26637406 | Molecular Mechanisms of Glucose-Stimulated GLP-1 Secretion | 2016 | Narrative Review |
| PMID-27287542 | The Incretin Hormone GLP-1 and Mechanisms Underlying Its Secretion | 2016 | Narrative Review |
| PMID-29364588 | Incretin Hormones: Their Role in Health and Disease | 2018 | Narrative Review |
| PMID-31002893 | GLP-1: Molecular Mechanisms and Outcomes of a Complex Signaling System | 2019 | Narrative Review |
References
- PMID-17928588: Holst JJ. The Physiology of Glucagon-Like Peptide 1. Physiol Rev. 2007;87(4):1409-1439.
- PMID-24811133: Shah M, Vella A. Effects of GLP-1 on Appetite and Weight. Rev Endocr Metab Disord. 2014;15(3):181-187.
- PMID-26637406: Kuhre RE et al. Molecular Mechanisms of Glucose-Stimulated GLP-1 Secretion. Clin Sci. 2016;130(2):79-91.
- PMID-27287542: Tian L, Jin T. The Incretin Hormone GLP-1 and Mechanisms Underlying Its Secretion. J Diabetes. 2016;8(6):753-765.
- PMID-29202475: Drucker DJ, Habener JF, Holst JJ. Discovery, Characterization, and Clinical Development of the Glucagon-Like Peptides. J Clin Invest. 2017;127(12):4217-4227.
- PMID-29364588: Nauck MA, Meier JJ. Incretin Hormones: Their Role in Health and Disease. Diabetes Obes Metab. 2018;20(Suppl 1):5-21.
- PMID-31002893: Smith NK et al. GLP-1: Molecular Mechanisms and Outcomes of a Complex Signaling System. Neurochem Int. 2019;128:94-105.
- PMID-33320179: McLean BA et al. Revisiting the Complexity of GLP-1 Action. Endocrine Reviews. 2021;42(2):101-132.
Related
#peptide #metabolic #subq