Tirzepatide

Tirzepatide

Once-weekly dual GIP/GLP-1 receptor agonist. FDA-approved for type 2 diabetes (Mounjaro, 2022), chronic weight management (Zepbound, 2023), and obstructive sleep apnea with obesity (Zepbound, 2024). The first dual-incretin agent in clinical practice.

Quick Facts

Property Value
Generic name Tirzepatide
Trade names Mounjaro (T2DM, 2022), Zepbound (obesity 2023, OSA 2024)
Also known as LY3298176
Category Weight & Metabolic
Tier T1 β€” FDA-Approved
Sequence 39-amino-acid modified peptide based on native GIP with substitutions enabling dual GLP-1 receptor binding
Molecular weight ~4,813 Da
PubChem CID 156588324 β€” registry record (tirzepatide/Zepbound synonyms, UNII OYN3CCI6QE). Note: the stored connectivity is the sodium salt (InChIKey AAPYRSPHYSKGIS-MCNPHUAVSA-N), not the free-peptide base
ChEBI (free-peptide parent) ChEBI:194186 β€” 3-star curated free-peptide parent (InChIKey BTSOGEDATSQOAF-SMAAHMJQSA-N); same molecular formula/MW as the PubChem CID
Structure accessions PDB 7FIM (tirzepatide–GLP-1R–Gs complex, 3.4 Γ… cryo-EM; chain P peptide) Β· PDB 7FIY (tirzepatide–GIPR–Gs complex, 3.4 Γ… cryo-EM) β€” Zhao et al. 2022 Nat Commun (PMID 35217653) Β· AlphaFold AF-P43220-F1 (GLP-1R, pLDDT 81.5) / AF-P48546-F1 (GIPR, pLDDT 78.5)
Structural modifications C20 fatty diacid moiety acylated at Lys20 via Ξ³-Glu-2Γ—OEG linker β†’ albumin binding for extended half-life
Administration Subcutaneous, once weekly
Half-life ~5 days (~116 hours) (Coskun et al., Mol Metab 2018; PMID: 30473097)
Tmax ~24–72 hours post-dose
Steady-state ~4 weeks at a given dose
Approved doses 2.5 mg, 5 mg, 7.5 mg, 10 mg, 12.5 mg, 15 mg weekly
FDA status (2026) Approved β€” T2DM; Approved β€” chronic weight management (BMI β‰₯30, or β‰₯27 + comorbidity); Approved β€” moderate-to-severe OSA with obesity; investigational for HFpEF, MASH, CKD
WADA status Not on the Prohibited List as of 2026 (verify annually)
Receptor profile GIP receptor agonist + GLP-1 receptor agonist (dual incretin)
Pregnancy category Avoid; washout β‰₯2 months before attempting conception recommended per label

Mechanism of Action

Tirzepatide is the first approved dual incretin receptor agonist, combining agonism at both the glucose-dependent insulinotropic polypeptide (GIP) receptor (GIPR, UniProt P48546) and the glucagon-like peptide-1 (GLP-1) receptor (GLP1R, UniProt P43220). The structural design underlying this dual activity is a modified native GIP sequence with amino-acid substitutions that extend binding affinity to the GLP-1 receptor while retaining full GIP receptor activity (Coskun et al., PMID: 30473097). The C20 fatty-diacid conjugation enables non-covalent albumin binding, producing a plasma half-life of approximately five days and permitting once-weekly subcutaneous administration.

Tirzepatide bound to GLP-1R (PDB 7FIM) and GIPR (PDB 7FIY): one 39-amino-acid peptide engaging two Class B/2 GPCRs
Figure 1 β€” Structure of the confirmed molecule: dual receptor engagement. The same 39-aa tirzepatide peptide (bright) bound in the extracellular + transmembrane domains of GLP-1R (left, PDB 7FIM) and GIPR (right, PDB 7FIY), each a Class B/2 GPCR (teal). Both are 3.4 Γ… cryo-EM active-state complexes with heterotrimeric Gs (G-protein hidden for clarity). This is the structural basis of dual incretin-receptor agonism: one engineered peptide, two receptors. Source: RCSB PDB 7FIM & 7FIY (Zhao et al. 2022 Nat Commun, PMID 35217653), rendered with PyMOL; peptide chain P sequence YAEGTFTSDYSIALDKIAQKAFVQWLIAGGPSSGAPPPS (Lys20 = C20-diacid acylation site). Educational in-silico structural artifact β€” not clinical or prescribing advice.

Why dual agonism matters

For years, GIP was regarded as the "forgotten" incretin β€” native GIP response is blunted in patients with type 2 diabetes, which led to skepticism about therapeutic GIP-agonism. Work by Samms, Coghlan, and Sloop synthesized the mechanistic case for combining GIP with GLP-1 agonism in the context of obesity and T2DM (Samms et al., PMID: 32396843). Three mechanisms are central:

  1. Complementary central appetite suppression. GLP-1 receptors in the arcuate nucleus, paraventricular nucleus, and area postrema drive satiety and nausea. GIP receptors also distribute across hypothalamic and brainstem regions, and their activation may attenuate the emetogenic effects of pure GLP-1 agonism while reinforcing satiety through distinct neuronal populations. Clinically, this translates to a favorable GI tolerability profile at weight-loss-equivalent doses compared with pure GLP-1 agonists (see SURMOUNT-5, PMID: 40353578).

  2. Adipose-tissue-specific effects. Mechanistic data from preclinical models and pharmacology studies suggests that GIP receptor activation in adipose tissue may improve adipocyte insulin sensitivity; the clinical significance of this beyond weight-loss-driven metabolic improvements is not yet established in human outcome trials (Samms et al., PMID: 32396843). Clinicians should interpret adipose-specific effects as mechanistic plausibility rather than proven independent clinical benefit.

  3. Enhanced insulin secretion with glucose dependency. Both GIP and GLP-1 receptors on pancreatic Ξ²-cells stimulate glucose-dependent insulin release. The dual stimulus produces greater glycemic efficacy than either alone, contributing to tirzepatide's superiority over semaglutide in head-to-head glycemic endpoints (SURPASS-2, PMID: 34170647).

Mechanism schematic: one tirzepatide molecule engages both GIPR and GLP-1R, driving Gas to adenylyl cyclase to cAMP/PKA and tissue-specific metabolic outputs
Figure 2 β€” Mechanism / pathway. One tirzepatide molecule engages both GIPR and GLP-1R (Class B/2 GPCRs) β†’ GΞ±s β†’ adenylyl cyclase β†’ cAMP/PKA, producing tissue-specific outputs β€” glucose-dependent insulin secretion (Ξ²-cell), central appetite suppression, and a GIPR-dependent adipose insulin-sensitivity contribution β€” that integrate to glycemic control and weight loss. Source: UniProt P43220 / P48546; ChEMBL CHEMBL4297839 dual-agonist MoA; Reactome R-HSA-418555 (GΞ±s), R-HSA-381676 (GLP-1 β†’ insulin secretion), R-HSA-373080 (Class B/2 receptors). Educational in-silico schematic β€” not clinical or prescribing advice.

Central vs peripheral effects

Tirzepatide's weight-loss mechanism is dominated by central appetite suppression and delayed gastric emptying, not by direct effects on basal metabolic rate. Patients report earlier satiety, reduced food reward, and decreased food noise β€” an experiential pattern consistent across the GLP-1 class but reported at higher magnitude with tirzepatide in clinical observation. Delayed gastric emptying contributes to both postprandial glycemic smoothing and to the common GI adverse-event profile (early satiety, nausea).

Differences from semaglutide at the receptor level

Both agents are GLP-1 receptor agonists, but only tirzepatide also activates GIP. At equipotent weight-loss doses, the receptor-level differences produce: (a) greater absolute weight-loss magnitude with tirzepatide (SURMOUNT-5, PMID: 40353578), (b) modest but consistent differences in GI tolerability in tirzepatide's favor, and (c) slightly different cardiometabolic signal patterns β€” tirzepatide showing stronger glycemic efficacy in T2DM per SURPASS-2 (PMID: 34170647); semaglutide with longer-duration cardiovascular outcomes data via SELECT (PMID: 37952131) and PIONEER-6 (PMID: 31185157).


Indications

FDA-approved

  • Type 2 diabetes mellitus (2022) β€” Mounjaro, adjunct to diet and exercise for glycemic control
  • Chronic weight management (2023) β€” Zepbound, for adults with BMI β‰₯30, or β‰₯27 with at least one weight-related comorbidity (hypertension, dyslipidemia, T2DM, obstructive sleep apnea, cardiovascular disease)
  • Moderate-to-severe obstructive sleep apnea with obesity (2024) β€” Zepbound, based on the SURMOUNT-OSA trial (PMID: 38912654)

Expanded clinical use (off-label but supported by clinical-trial evidence)

  • Heart failure with preserved ejection fraction + obesity β€” SUMMIT trial showed reduction in cardiovascular death or worsening heart failure events (PMID: 39555826). Not yet FDA-labeled for HFpEF as of early 2026; labeling update anticipated.
  • Metabolic dysfunction-associated steatohepatitis (MASH) β€” Phase 2 SYNERGY-NASH (Loomba R, Sanyal AJ et al., NEJM 2024;391(4):299-310, PMID 38856224) demonstrated MASH resolution without worsening fibrosis in 62% of patients at 15 mg (vs 10% placebo), plus dose-responsive fibrosis improvement. First Phase 2 GLP-1/GIP dual agonist trial in biopsy-proven MASH with fibrosis (F2/F3). Phase 3 programs are in active development; MASH indication not yet on label as of April 2026
  • Pre-bariatric optimization and post-bariatric weight regain β€” growing off-label use; no Phase 3 RCT evidence as of 2026

Investigational

  • Chronic kidney disease in T2DM with obesity (analogous to the FLOW-for-semaglutide paradigm, PMID: 38785209)
  • Polycystic ovary syndrome with obesity β€” case-series-level evidence only
  • Alzheimer's disease and cognitive decline β€” early preclinical interest in incretin-axis neuroprotection; no confirmatory human data

Dosing

Standard FDA-approved titration schedule

Both Mounjaro and Zepbound use the same titration schedule, adjusted up by 2.5 mg every 4 weeks as tolerated:

Week Dose Notes
1–4 2.5 mg once weekly Starter dose; acclimates GI tolerance rather than targeting efficacy
5–8 5 mg once weekly First therapeutic dose. Many patients stabilize here.
9–12 7.5 mg once weekly Incremental escalation
13–16 10 mg once weekly Frequently a maintenance dose
17–20 12.5 mg once weekly For patients requiring additional weight loss or glycemic control
21+ 15 mg once weekly Maximum approved dose

When to hold vs. escalate

Per label and clinical practice:

  • Escalate if the patient tolerates the current dose for the full 4-week interval and has not yet reached the target response (goal HbA1c in T2DM, goal weight-loss rate, or BMI target). Typical weight loss at 5 mg is 5–8% over 16 weeks; at 15 mg, approximately 15–22% over 72 weeks (SURMOUNT-1, PMID: 35658024).
  • Hold (maintain current dose an additional 4 weeks) if significant GI symptoms (persistent nausea, vomiting, severe early satiety preventing adequate nutrition, or symptomatic volume contraction) occur at dose escalation.
  • Reduce by one dose step if adverse effects persist beyond 4 weeks at the current dose or if dehydration/AKI risk is present.

Compounded tirzepatide dosing variants

During the FDA's designated shortage period (ending October 2024), 503A and 503B pharmacies compounded tirzepatide at non-standard concentrations and sometimes with non-standard salts (tirzepatide sodium rather than tirzepatide base) β€” these are not chemically identical to the branded product. Compounded dosing has historically been based on branded-equivalent mg/mL rather than on rigorous pharmacokinetic bridging. Following the end of the shortage, FDA enforcement against 503A compounding of tirzepatide has increased, with ongoing litigation and regulatory activity as of early 2026. See the Compounding Pharmacy Evaluation Rubric for clinician guidance on evaluating compounded supply.

Micro-dosing protocols

Micro-dosing (e.g., weekly doses below 2.5 mg, or every-other-week administration at 2.5–5 mg) has emerged as a clinician-driven approach, primarily for:

  • Patients with extreme GI sensitivity
  • Patients targeting modest weight loss (5–10%) without maximum-dose escalation
  • Maintenance therapy after goal weight achievement

There is no FDA-approved micro-dosing protocol and no Phase 3 RCT evidence supporting clinical outcomes at sub-therapeutic doses. Clinicians should counsel patients that micro-dosing is off-label with limited efficacy and pharmacokinetic evidence.

Weight-based adjustments

FDA label does not require weight-based dose adjustment. Real-world practice occasionally extends intervals (12.5 mg β†’ 15 mg) for patients >150 kg who plateau, though the evidence supporting additional benefit above 15 mg is limited and not supported by published RCT data.

Maintenance vs. induction

SURMOUNT-4 established that discontinuation leads to rapid weight regain (PMID: 38078870). Maintenance dosing strategies under clinical investigation include:

  • Continuing at the peak escalation dose indefinitely (approved strategy)
  • Stepping down to a lower maintenance dose (e.g., 5–10 mg) after goal achievement β€” clinically practiced but not RCT-validated for sustained weight maintenance
  • Rotating with alternative agents (e.g., CJC-1295/Ipamorelin, AOD-9604) for metabolic maintenance phases β€” no RCT evidence

Pharmacokinetics

  • Half-life: ~5 days (approximately 116 hours), supporting once-weekly dosing (Coskun et al., PMID: 30473097)
  • Tmax: 24–72 hours post-dose depending on injection site
  • Volume of distribution: ~10.3 L
  • Clearance: Proteolytic degradation of the peptide backbone; renal and hepatic clearance are minor contributors
  • Steady-state: achieved approximately 4 weeks after a given dose
  • Bioavailability: ~80% absolute bioavailability from subcutaneous injection

Renal impairment

Per the FDA label, no dose adjustment is required across the spectrum of renal function, including in patients on hemodialysis. However, real-world caution applies because:

  • Volume-contraction from GI adverse effects can precipitate acute kidney injury in patients with baseline eGFR <60 mL/min/1.73 mΒ²
  • Dose titration should proceed more conservatively in patients with CKD Stage 3–5

Hepatic impairment

Limited dedicated pharmacokinetic data. Per label, no adjustment required. β€” clinician judgment should guide use in decompensated cirrhosis, where GI adverse effects may be less tolerable and drug-drug interactions with other hepatically cleared agents may be complex.


Contraindications

  • Personal or family history of medullary thyroid carcinoma (MTC) β€” FDA boxed warning. Rodent C-cell tumor signal not mechanistically ruled out in humans.
  • Multiple endocrine neoplasia syndrome type 2 (MEN 2) β€” FDA boxed warning.
  • Prior severe hypersensitivity to tirzepatide or any excipient.
  • Pregnancy β€” avoid; washout of at least 2 months before attempting conception is commonly recommended; specific timing guidance should be individualized with a reproductive endocrinology consultant.
  • Breastfeeding β€” excretion into human milk not definitively characterized; decision requires individual risk-benefit assessment.
  • Active pancreatitis β€” absolute contraindication; history of pancreatitis warrants caution and shared decision-making.
  • Severe gastroparesis β€” delayed gastric emptying from tirzepatide may worsen symptoms and nutritional status.

Drug Interactions

Oral contraceptives

Delayed gastric emptying reduces peak oral drug absorption, particularly during titration. For patients relying on oral contraceptives, backup non-hormonal contraception should be used for 4 weeks after every dose escalation (FDA label). Consider switching to a long-acting reversible contraceptive method before initiation for patients where pregnancy prevention is critical.

Levothyroxine

Due to delayed gastric emptying, levothyroxine absorption may be affected. Counsel patients to take levothyroxine 30–60 minutes before tirzepatide dosing when possible, on an empty stomach. Monitor TSH at 6–8 weeks and after each dose escalation.

Warfarin

INR monitoring should be more frequent during titration phases because altered gastric emptying may shift warfarin absorption and metabolism. No systematic interaction studies have established a quantitative interaction factor.

Insulin and sulfonylureas (T2DM patients)

Risk of hypoglycemia increases when tirzepatide is combined with insulin or sulfonylureas. Typical approach: reduce background insulin by 15–20% at tirzepatide initiation and after each dose escalation; reduce sulfonylurea dose proportionally or consider discontinuation as glycemic control improves.

Grapefruit

Tirzepatide is a peptide cleared by proteolysis and is not a CYP substrate. No grapefruit or CYP-mediated interactions are expected.

Other oral agents

For any oral medication with a narrow therapeutic index (e.g., digoxin, phenytoin, levothyroxine, immunosuppressants), monitor for altered absorption during titration and after dose escalations.


Adverse Events

Incidence data reflect pooled SURMOUNT and SURPASS trial populations (SURMOUNT-1 PMID: 35658024; SURMOUNT-2 PMID: 37385280; SURPASS-2 PMID: 34170647).

Gastrointestinal (most common)

Event Incidence at 15 mg Typical timing Management
Nausea 24–33% Peaks during titration, weeks 1–8; improves with continued dosing Anti-emetic (ondansetron 4 mg) as needed; split meals; hold dose escalation
Diarrhea 17–22% Dose-dependent Loperamide as needed; dietary fiber
Vomiting 10–15% Often during early titration Hydration; anti-emetic; dose reduction if persistent
Constipation 8–12% May persist throughout therapy Fiber, osmotic laxatives, PEG-3350
Dyspepsia 8–10% Variable Acid suppression as indicated; rule out gastroparesis
Abdominal pain 6–10% If severe or persistent, evaluate for pancreatitis or cholecystitis

Pancreatitis

Incidence in trials ~0.1–0.2%. Presents with persistent severe mid-epigastric pain radiating to the back, often with elevated lipase. Discontinue tirzepatide immediately on suspicion. Most events in trials were mild; severe or recurrent events warrant class discontinuation.

Class-level meta-analysis (Wen 2025, PMID 40988099, Endocrinol Diabetes Metab 2025;8(5):e70113): Systematic review of 62 RCTs (n=66,232) reports a pooled RR of 1.44 (95% CI 1.09-1.89, P=0.009) for acute pancreatitis across the GLP-1 RA class (including tirzepatide). Association becomes non-significant when stratified by background medication, and absolute event rates remain low (<1-2% per year). Authors frame the effect as "slightly increased risk, likely minimal" given methodological caveats. Clinical action: maintain standard pancreatitis monitoring (history of pancreatitis as relative contraindication; discontinue if suspected) β€” the Wen data supports continued vigilance rather than escalated concern.

Gallbladder events

Cholelithiasis and acute cholecystitis occurred at approximately 0.6–0.7% in SURMOUNT-1 (PMID: 35658024), consistent with the known GLP-1 class signal. Rapid weight loss accelerates biliary sludge formation; counsel patients on symptoms of right-upper-quadrant pain, fever, or post-prandial pain.

Hypoglycemia

Rare in monotherapy; substantial only when co-administered with insulin or sulfonylureas in T2DM. Counsel on symptom recognition and ensure glucose monitoring.

Injection site reactions

Typically mild. Rotate injection sites (abdomen, thigh, upper arm). Severe or recurrent reactions may indicate hypersensitivity.

Diabetic retinopathy β€” nuanced evidence

Within the SURPASS clinical trial program (Phase 3), no increased risk of diabetic retinopathy progression was observed (Rosenstock J et al., Diabetes Care 2023;46:1986-1992; and SURPASS-2, FrΓ­as JP et al., N Engl J Med 2021;385:503-515, PMID: 34170647). However, clinical trials excluded patients with unstable or severe baseline retinopathy.

Real-world data present a more nuanced picture. A 2025 retrospective cohort study (Buckley AJ et al., Diabetologia 2025, PMID: 40637847) of 6,869 matched patients found tirzepatide associated with increased odds of new-onset proliferative diabetic retinopathy (OR 2.15, 95% CI 1.24–3.74) specifically in patients with mild non-proliferative diabetic retinopathy plus maculopathy (grade R1M1) or moderate-to-severe NPDR at baseline. Notably, tirzepatide was associated with reduced odds of new-onset retinopathy in patients without retinopathy at baseline (OR 0.73).

A meta-analysis of the SURPASS trials (Popovic DS et al., Diabetes Obes Metab 2024;26(6):2497-2500, PMID: 38456523) found no signal within the controlled trial population.

Clinical interpretation: The Buckley finding likely reflects the well-documented phenomenon of "early worsening of diabetic retinopathy" with rapid glycemic improvement (Feldman-Billard 2018, Bain 2019) rather than direct tirzepatide toxicity. Patients with existing moderate-to-severe NPDR should have ophthalmology consultation before tirzepatide initiation and more frequent retinal screening during the first 12 months of treatment, per ADA 2024 Standards of Care recommendation to assess retinopathy at time of rapid glycemic changes.

Dehydration and acute kidney injury

Persistent vomiting or severe diarrhea can precipitate volume contraction and pre-renal AKI, particularly in elderly patients or those on diuretics/ACE-inhibitors. Counsel all patients on hydration and threshold for calling the clinician.

NAION signal (non-arteritic anterior ischemic optic neuropathy) β€” class-differentiated

A single-center retrospective cohort study from Mass Eye and Ear (Hathaway JT et al., JAMA Ophthalmol 2024;142:732-739, PMID: 38958939) reported hazard ratio 4.28 (95% CI 1.62–11.29) in patients with T2D and HR 7.64 (95% CI 2.21–26.36) in overweight/obese patients for semaglutide prescription, with 36-month cumulative incidence 6.7% vs. 0.8% in the obese cohort.

Comparative pharmacovigilance β€” class differentiation (Lakhani 2025): Lakhani M, Kwan ATH, Mihalache A et al. (Am J Ophthalmol 2025 Sep;277:148-168, PMID: 40383360) performed a population-based observational pharmacovigilance study across 180 countries using FAERS (n=12,936,341) and WHO VigiBase (n>35,000,000). Key findings differentiating the two agents:

  • Semaglutide NAION / ION: FAERS ROR 11.12 (95% CI 8.15–15.16); VigiBase ROR 68.58 (95% CI 16.75–280.67) vs. metformin β€” strongly significant
  • Tirzepatide diabetic retinopathy: FAERS ROR 3.06 (95% CI 2.05–4.58) β€” significant
  • Tirzepatide NAION / ION: no significant association at the same analytical threshold

The Lakhani analysis supports a class-differentiated ocular safety profile β€” tirzepatide's signal pattern is narrower than semaglutide's in this pharmacovigilance dataset.

Danish nationwide cohort (Grauslund 2024): A 5-year longitudinal cohort of 424,152 Danish T2D patients (Int J Retina Vitreous 2024, PMID: 39696569) independently showed HR 2.19 (95% CI 1.54–3.12) for NAION in semaglutide-exposed vs. non-exposed. Tirzepatide exposure was not analyzed in this dataset due to limited Danish tirzepatide uptake during the period.

Regulatory status divergence: The European Medicines Agency required updated warning labels for semaglutide products in August 2024 to include NAION risk. The EMA PRAC formally concluded in June 2025 that NAION is a "very rare" side effect of semaglutide (up to 1 in 10,000 patients). The US FDA has not updated US labels as of April 2026. Clinicians should counsel patients about the NAION signal for semaglutide specifically; evidence for a tirzepatide-NAION association is substantially weaker.

Clinical implication for tirzepatide: For patients with ophthalmic risk factors (optic disc crowding, history of NAION in fellow eye, crowded-disc anatomy), the weight of comparative pharmacovigilance evidence favors tirzepatide over semaglutide where clinical equipoise exists. This is not a blanket rule; individual patient factors (insurance coverage, glycemic target, CV outcomes data) still matter.

Suicidal ideation

EMA and FDA reviews completed 2023–2024 found no causal link between GLP-1 class agents and suicidal ideation at a population level. Individual-level monitoring remains standard-of-care, particularly for patients with baseline psychiatric history. Screen with PHQ-9 at baseline and at routine follow-up.


Monitoring Parameters

Baseline

  • Weight, waist circumference, BMI
  • Vital signs including resting heart rate
  • HbA1c (T2DM) or fasting glucose + HOMA-IR (obesity)
  • Lipid panel
  • Comprehensive metabolic panel (eGFR, LFTs)
  • TSH (baseline for drug-interaction monitoring)
  • Pregnancy test in women of reproductive potential
  • Retinal examination if T2DM with known or suspected retinopathy
  • Mental-health screening (PHQ-9)
  • Thyroid palpation and family history assessment for MTC/MEN 2
  • DEXA body composition if age >50, post-menopausal, or sarcopenic-risk phenotype
  • Document baseline OSA screening (Epworth Sleepiness Scale, STOP-BANG) in patients with obesity

3 months

  • Weight, waist circumference, BMI
  • HbA1c (T2DM)
  • Lipid panel
  • eGFR, LFTs
  • TSH (if dose-escalating concurrent levothyroxine)
  • PHQ-9

6 months and annually

  • All baseline parameters
  • DEXA body composition if on weight-loss indication
  • Retinal exam for T2DM
  • Assessment of ongoing therapy goals and response

Ongoing

  • Vital signs at each visit
  • Annual thyroid palpation
  • Adverse event review at each encounter

Special Populations

Pediatric (under 18)

Youth type 2 diabetes (emerging evidence): SURPASS-PEDS (Hannon TS et al., Lancet 2025;406(10511):1484-1496, PMID 40975112) β€” Phase 3 randomised, double-blind, placebo-controlled trial of tirzepatide 5 mg and 10 mg weekly in n=99 children and adolescents (mean age 14.7 years) with youth-onset T2D inadequately controlled on metformin and/or basal insulin. Primary endpoint (week 30 HbA1c): tirzepatide -2.23% vs placebo +0.05% β€” substantial glycemic-control advantage. Dose-responsive BMI reduction. Safety profile consistent with adult SURPASS program (predominantly GI). FDA indication expansion for pediatric T2D anticipated based on this data; verify current FDA Prescribing Information at time of use.

Adolescent obesity (pending): SURMOUNT-PEDS Phase 3 trial in adolescents aged 12–17 with obesity is ongoing; read-out anticipated. No obesity-indication FDA approval for under-18 populations as of April 2026. Off-label use in adolescent obesity should be considered only within specialist pediatric obesity-medicine care and with explicit informed consent pending SURMOUNT-PEDS data and regulatory action.

Companion pediatric evidence: Semaglutide (Wegovy) for adolescent obesity β€” PMID 36322838 (STEP TEENS).

Geriatric (over 65)

Weight loss in older adults is clinically valuable but carries disproportionate risk of sarcopenia and functional decline. Non-negotiable clinical adjuncts:

  • Resistance training 2–3 sessions weekly (see Lean Mass Preservation β€” CJC/Ipamorelin + MOTS-C During Weight Loss)
  • Protein intake targets of 1.2–1.6 g/kg of goal body weight per day
  • DEXA at baseline and every 6 months
  • Consideration of adjunctive CJC-1295/Ipamorelin or Tesamorelin in patients with low baseline lean mass β€” this is practice-level guidance, not RCT-validated

Chronic kidney disease

Per FDA label, no dose adjustment required. Clinical cautions:

  • Monitor eGFR and hydration status more frequently (monthly during titration)
  • Use conservative dose escalation (maintain dose an extra 4 weeks at each step)
  • Particular caution in patients on ACE-inhibitors, ARBs, or SGLT2 inhibitors where volume contraction can compound

Hepatic impairment

Limited dedicated data. Generally safe in mild-to-moderate impairment per pharmacokinetic principles (proteolytic clearance); use cautiously and monitor LFTs in decompensated cirrhosis.

Post-bariatric surgery

Emerging clinical use for weight regain and inadequate response post-bariatric. No RCT evidence. GI tolerability may be reduced in anatomically altered populations (Roux-en-Y gastric bypass, sleeve gastrectomy). Consider starting and remaining at 2.5–5 mg for extended periods.

Pregnancy and preconception

Contraception required during treatment. Washout of at least 2 months (i.e., ~5 half-lives) is commonly recommended before attempting conception, though no firm FDA guidance exists. Coordinate with reproductive endocrinology.


Muscle and Bone Preservation

A growing body of evidence β€” both from SURMOUNT DEXA sub-studies and observational data β€” confirms that approximately 25–40% of total weight loss with tirzepatide is lean mass, in the absence of structured resistance training and adequate protein intake. The consequences are not cosmetic; they are functional (sarcopenic weakness, fall risk, bone density decline in post-menopausal women) and metabolic (reduced resting metabolic rate accelerates weight regain after discontinuation).

Evidence base

  • SURMOUNT-1 body composition sub-analysis: lean mass loss proportional to total weight loss, broadly similar to historical caloric-restriction-only data (PMID: 35658024).
  • SURMOUNT-5 (tirzepatide vs semaglutide): tirzepatide's greater absolute weight loss translates to greater absolute lean mass loss, emphasizing the need for structured preservation strategies (PMID: 40353578).

Clinical recommendations

  1. Resistance training 2–3 times per week β€” non-negotiable. Body-weight progression, resistance bands, or supervised gym work. Minimum ~20 minutes per session.
  2. Protein intake 1.2–1.6 g/kg of goal body weight daily β€” distributed across 3–4 meals. Whey or plant-based protein supplementation acceptable.
  3. DEXA scanning at baseline and every 6 months during active weight loss. If lean mass loss >30% of total weight loss, intensify resistance training and consider adjunctive GH-secretagogue therapy (CJC-1295/Ipamorelin, Tesamorelin) as a body-composition support strategy (non-FDA-labeled for this indication).
  4. Bone density monitoring β€” baseline DEXA BMD in post-menopausal women and in men >60. Repeat every 24 months during active weight loss.
  5. Activity tracking β€” step count, stairs climbed, measured lean body metrics (hand-grip dynamometry) provide functional anchors beyond scale weight.

Discontinuation

The SURMOUNT-4 reality

SURMOUNT-4 randomized tirzepatide-treated patients who had achieved weight loss to continued tirzepatide or placebo. Patients switched to placebo regained approximately 14% body weight by 88 weeks, while those continuing tirzepatide maintained their loss (PMID: 38078870). This establishes tirzepatide (and by extension the GLP-1 class) as chronic therapy, not episodic.

Tapering vs abrupt discontinuation

No RCT has compared tapered vs abrupt discontinuation. Clinical consensus favors:

  • Gradual step-down (reduce by 2.5 mg every 4–8 weeks) to minimize GI and appetite rebound
  • Intensified lifestyle support during taper period
  • Patient-reported outcome monitoring (appetite, food reward, body weight, mood)

When to discontinue vs. dose-reduce vs. switch

Scenario Action
Goal achieved, insurance loss, or patient preference Discuss maintenance dose + lifestyle intensification; do not abruptly stop
Pregnancy planned Stop; washout β‰₯2 months before conception
Pancreatitis or suspected pancreatitis Discontinue immediately; avoid class rechallenge after confirmed episode
Persistent GI intolerance at lowest titration dose Consider semaglutide trial (different receptor profile) vs. discontinuation
Acute kidney injury with volume depletion Hold until recovery; resume at lower dose with more gradual titration
MTC diagnosis Discontinue permanently

Compounded Tirzepatide β€” Regulatory History

2022–October 2024: Tirzepatide was on the FDA drug shortage list. During this period, 503A compounding pharmacies and 503B outsourcing facilities were permitted to compound tirzepatide under sections 503A and 503B of the FD&C Act (respectively).

October 2024: FDA declared the tirzepatide shortage resolved. Under the 503A framework, individual-patient compounding became restricted; 503B outsourcing of tirzepatide likewise narrowed.

Late 2024 – 2025: Lilly initiated litigation against multiple 503B outsourcing facilities and telehealth companies supplying compounded tirzepatide. Some 503B facilities continue limited compounding under clinical-need exceptions; the legal landscape remains active.

2026: Ongoing regulatory activity and litigation. Clinicians sourcing compounded tirzepatide should:

  • Verify the pharmacy's current licensure and any relevant consent orders
  • Apply the Compounding Pharmacy Evaluation Rubric vendor-neutral framework
  • Counsel patients on supply stability: branded Zepbound (via Lilly Direct or pharmacy) is the most stable supply chain in 2026
  • Document every sourcing decision in the chart

Clinical comparability of compounded to branded tirzepatide has not been established in RCTs. Published pharmacokinetic bridging data are limited. Some compounded products have used tirzepatide sodium salt, which is not chemically identical to tirzepatide base used in Mounjaro/Zepbound.


Cost and Access (2026 snapshot)

  • Mounjaro / Zepbound list price (branded): approximately $1,060/month AWP (varies by pharmacy and insurance negotiation)
  • Lilly Direct DTC self-pay: $349 (2.5 mg, starter) to $649 (higher doses) β€” single-vial pricing; requires self-administration
  • Commercial insurance with prior authorization: $25–$550 per month after deductible (highly variable)
  • Compounded tirzepatide (post-shortage): historically $250–$450/month; narrowing supply as regulatory enforcement increases
  • Patient assistance: Lilly Cares and manufacturer savings card programs exist for uninsured or underinsured patients

The "$100/month compounded vs. branded" calculus of 2023–2024 has largely collapsed under 2025–2026 enforcement; clinicians should not assume low-cost compounded supply will remain available throughout a patient's course of therapy. See GLP-1 Cost-of-Care Analysis for detailed cost-of-care modeling across all major GLP-1 agents.


Emerging Combinations

Tirzepatide + amylin analogs

Cagrilintide (long-acting amylin analog) has been trialed in combination with semaglutide (CagriSema program) with promising weight-loss results. Analogous tirzepatide + cagrilintide combination development is ongoing. No FDA-approved combination product exists as of 2026.

Tirzepatide + retatrutide

Not yet trialed in combination β€” these are currently comparator agents within the dual/triple-agonist class. Retatrutide Phase 2 data show greater weight-loss magnitude as a triple agonist but also greater adverse-event burden.

Sequential therapy

Some clinicians use tirzepatide for induction (aggressive weight-loss phase) followed by lower-intensity maintenance with semaglutide or alternative agents. No RCT supports this sequencing pattern. Practice-level consideration only.


Evidence Base

Trial Study PMID Design Primary Outcome Evidence Level
SURMOUNT-1 Jastreboff 2022 NEJM 387:205-216 35658024 Phase 3 RCT, obesity without T2DM, 72 wk βˆ’22.5% body weight at 15 mg vs. βˆ’2.4% placebo Ib
SURMOUNT-2 Garvey 2023 Lancet 402:613-626 37385280 Phase 3 RCT, obesity with T2DM, 72 wk βˆ’14.7% body weight at 15 mg Ib
SURMOUNT-3 Wadden 2023 Nat Med 29:2909-2918 37840095 Phase 3, post-lifestyle-run-in, 72 wk Additional βˆ’21.1% beyond lifestyle run-in Ib
SURMOUNT-4 Aronne 2024 JAMA 331:38-48 38078870 Phase 3, maintenance withdrawal, 88 wk +14% regain on withdrawal vs. continued Ib
SURMOUNT-5 Aronne 2025 NEJM 393:26-36 40353578 Phase 3 head-to-head vs semaglutide, 72 wk βˆ’20.2% vs βˆ’13.7% (P<0.001) Ib
SURMOUNT-OSA Malhotra 2024 NEJM 391:1193-1205 38912654 Phase 3 dual trials, OSA + obesity, 52 wk Reduced AHI + weight; basis for OSA label Ib
SUMMIT (HFpEF) Packer 2024 NEJM 39555826 Phase 3, HFpEF + obesity, β‰₯52 wk CV death/HF event HR 0.62 Ib
SURPASS-2 Frias 2021 NEJM 385:503-515 34170647 Phase 3 head-to-head vs semaglutide in T2DM Superior HbA1c reduction at 5/10/15 mg vs semaglutide 1 mg Ib
Mechanism Coskun 2018 Mol Metab 18:3-14 30473097 Preclinical + PK Dual agonist characterization III
GIP review Samms 2020 TEM 31:410-421 32396843 Narrative review GIP-GLP-1 combination rationale IV
Comparator (semaglutide SELECT) Lincoff 2023 NEJM 37952131 Phase 3, obesity CV outcomes Semaglutide βˆ’20% MACE vs placebo Ib
Comparator (oral semaglutide CV) Husain 2019 NEJM (PIONEER-6) 31185157 Phase 3 CV safety Noninferior MACE Ib
Comparator (semaglutide kidney) Perkovic 2024 NEJM (FLOW) 38785209 Phase 3 CKD outcomes in T2DM Major kidney events HR 0.76 Ib
Historical (liraglutide SCALE) Pi-Sunyer 2015 NEJM 26132939 Phase 3 obesity βˆ’8% body weight at 3.0 mg Ib
Historical (semaglutide STEP-1) Wilding 2021 NEJM 33567185 Phase 3 obesity βˆ’14.9% body weight at 2.4 mg Ib
SYNERGY-NASH (MASH) Loomba/Sanyal 2024 NEJM 391(4):299-310 38856224 Phase 2 RCT, biopsy-proven MASH + F2/F3 fibrosis, 52 wk 62% MASH resolution at 15 mg vs 10% placebo; dose-responsive fibrosis improvement Ib
SURPASS-PEDS (youth T2D) Hannon 2025 Lancet 406(10511):1484-1496 40975112 Phase 3 RCT, T2D in youth ages 10-17, 30 wk primary HbA1c βˆ’2.23% vs placebo +0.05% at wk 30 Ib
NAION safety (Hathaway cohort) Hathaway 2024 JAMA Ophthalmol 142:732-739 38958939 Retrospective single-center matched cohort HR 4.28 T2D / 7.64 overweight-obese for semaglutide (tirz context) III
NAION safety (Danish/Norwegian) Danish/Norwegian 2024 Int J Retina Vitreous 39696569 Nationwide cohort (n=424,152) HR 2.19 (95% CI 1.54-3.12) at 5 yr for semaglutide β€” cross-class NAION context II
NAION class-differentiation (Lakhani) Lakhani 2025 Am J Ophthalmol 40383360 180-country pharmacovigilance (FAERS + VigiBase) Sema FAERS ROR 11.12 / VigiBase ROR 68.58; no significant NAION signal for tirzepatide II
STEP TEENS (adolescent obesity β€” semaglutide comparator) Weghuber 2022 NEJM 387(24):2245-2257 36322838 Phase 3 RCT, adolescents with obesity, 68 wk BMI βˆ’16.1% vs +0.6% placebo Ib
SURPASS retinopathy meta-analysis (Popovic) Popovic 2024 Diabetes Obes Metab 26(6):2497-2500 38456523 Meta-analysis of SURPASS Phase 3 program No EWDR signal within trial-eligible population; patients with significant baseline retinopathy excluded II
Ophthalmic pharmacovigilance (Cheng) Cheng 2026 J Endocrinol Invest 49(2):425-433 41021211 Multi-database disproportionality (FAERS + VigiBase) Class-level ocular AE signals; dulaglutide retinopathy signal; semaglutide NAION dominant II
Pancreatitis class meta-analysis (Wen) Wen 2025 Endocrinol Diabetes Metab 8(5):e70113 40988099 Meta-analysis of 62 GLP-1 RA RCTs (n=66,232) RR 1.44 (95% CI 1.09-1.89) pancreatitis; signal attenuates with stratification II

Related

Module 5 Lesson References

  • Lesson 5.3 β€” Tirzepatide Deep Dive (primary)
  • Lesson 5.2 β€” Semaglutide (comparator context)
  • Lesson 5.4 β€” Pipeline peptides (retatrutide comparison)
  • Lesson 5.8 β€” Titration, Side Effects, and Non-Responder Algorithm
  • Lesson 5.10 β€” Integrated case study

Tags

#peptide #glp-1 #gip #weight-loss #t2dm #obesity #osa #hfpef #tier1 #fda-approved #surmount #surpass #zepbound #mounjaro